DGKZ Antibody

Uniprot: Q13574-1

Gene Name: DGKZ

Immunogen: Recombinant human DGKZ

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 98%

Core Sequence: STGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQR

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 99%

Alternative gene names: DAGK6

Alternative protein names: diacylglycerol kinase zeta

Protein name: Diacylglycerol kinase zeta

Clone No.: K49027_7F9

Antigen Species: Human

Target Name: DGKZ

IHC Verification: succeed

IHC Dilution: 1:200

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-11994

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1026-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1026-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Western Blotting, Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG2a
• Wirt: Mouse
• Konjugat: Unconjugated