Dipk2a Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Deleted in autism protein 1 homolog

Protein Size: 444

Purification: Affinity Purified

• Artikelnummer: AVIARP55633_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55633_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 68861
• Wirt: Rabbit