Uniprot: P25685
Gene Name: DNAJB1
Immunogen: Recombinant human DNAJB1
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 95%
Core Sequence: LARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 56%, Pig - 97%, Cynomolgus monkey - 98%
Alternative gene names: DNAJ1；HDJ1；HSPF1
Alternative protein names: DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; Heat shock 40 kDa protein 1; HSP40; Heat shock protein 40; Human DnaJ protein 1; hDj-1
Protein name: DnaJ heat shock protein family (Hsp40) member B1
Clone No.: K92020_11D1
Antigen Species: Human
Target Name: DNAJB1
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: succeed
IP Dilution: 1:100
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-769
Cross reactivity: Not tested
Deutsch
English
