DOK6 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DOK6 is a member of the DOK (see DOK1; MIM 602919) family of intracellular adaptors that play a role in the RET (MIM 164761) signaling cascade (Crowder et al., 2004 [PubMed 15286081]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DOK6

Molecular Weight: 38

Peptide Sequence: Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Docking protein 6

Protein Size: 331

Purification: Affinity Purified

• Artikelnummer: AVIARP55502_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55502_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 220164
• Wirt: Rabbit