EPC2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: EPC2 may play a role in transcription or DNA repair.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPC2

Key Reference: N/A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Enhancer of polycomb homolog 2

Protein Size: 807

Purification: Affinity purified

• Artikelnummer: AVIARP55311_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55311_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26122
• Wirt: Rabbit