FAM78A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of FAM78A remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM78A

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM78A

Protein Size: 283

Purification: Affinity Purified

• Artikelnummer: AVIARP55410_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55410_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 286336
• Wirt: Rabbit