FAM79B Antibody - C-terminal region : FITC

FAM79B Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55878_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM79B

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: AHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein p63-regulated gene 1 protein

Protein Size: 275

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55878_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55878_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285386
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×