FASTKD2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FAST kinase domain-containing protein 2

Protein Size: 710

Purification: Affinity Purified

• Artikelnummer: AVIARP55108_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55108_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22868
• Wirt: Rabbit