FBXL4 Antibody - N-terminal region : Biotin

FBXL4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54856_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL4

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box/LRR-repeat protein 4

Protein Size: 621

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54856_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54856_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26235
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×