English
FDXR Antibody - middle region : HRP
FDXR Antibody - middle region : HRP
Artikelnummer
AVIARP54707_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FDXR
Key Reference: Trapasso,F., (2008) J. Biol. Chem. 283 (20), 13736-13744
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial
Protein Size: 491
Purification: Affinity Purified
Description of Target: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FDXR
Key Reference: Trapasso,F., (2008) J. Biol. Chem. 283 (20), 13736-13744
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial
Protein Size: 491
Purification: Affinity Purified
| Artikelnummer | AVIARP54707_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54707_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 2232 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
