FGF2 Antibody

FGF2 Antibody
Artikelnummer
ASBKC-070-100
Verpackungseinheit
100 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: P09038

Gene Name: FGF2

Immunogen: Recombinant human FGF2

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 97%

Core Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%

Alternative gene names: FGFB

Alternative protein names: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Protein name: Fibroblast growth factor 2

Product panel: Cytokines,Neuroscience Biomarkers

Clone No.: KT1

Antigen Species: Human

Target Name: FGF2

IHC Verification: succeed

IHC Dilution: 1:500

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:200

Antigen ID: PP-3005

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-070-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-070-100
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Immunoprecipitation, Western Blotting, ELISA, Immunohistochemistry, Immunocytochemistry
Isotyp IgG1
Human Gene ID 2247
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×