FKBPL Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FKBPL

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: FK506-binding protein-like

Protein Size: 349

Purification: Affinity Purified

• Artikelnummer: AVIARP57598_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57598_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 63943
• Wirt: Rabbit