FLJ35767 Antibody - middle region : Biotin

FLJ35767 Antibody - middle region : Biotin
Artikelnummer
AVIARP56005_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ35767

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56005_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56005_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 400629
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×