FLJ35767 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ35767

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified

• Artikelnummer: AVIARP56005_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56005_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 400629
• Wirt: Rabbit