FYN Antibody - middle region : FITC

FYN Antibody - middle region : FITC
Artikelnummer
AVIARP55568_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FYN

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Fyn

Protein Size: 537

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55568_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55568_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2534
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×