GABARAP Antibody - C-terminal region : HRP

GABARAP Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58902_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: IHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-aminobutyric acid receptor-associated protein

Protein Size: 117

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58902_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58902_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11337
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×