GANAB Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GANAB cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc2Man9GlcNAc2 oligosaccharide precursor of immature glycoproteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GANAB

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neutral alpha-glucosidase AB

Protein Size: 944

Purification: Affinity Purified

• Artikelnummer: AVIARP55868_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55868_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23193
• Wirt: Rabbit