GBP2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP. Interferons are cytokines that have antiviral effects and inhibit tumor cell proliferation. They induce a large number of genes in their target cells, including those coding for the guanylate-binding proteins (GBPs). GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). The protein encoded by this gene is a GTPase that converts GTP to GDP and GMP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Key Reference: Lukasiewicz,R., (2007) J. Biol. Chem. 282 (32), 23036-23043

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced guanylate-binding protein 2

Protein Size: 591

Purification: Affinity Purified

• Artikelnummer: AVIARP54714_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54714_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2634
• Wirt: Rabbit