GCFC2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCFC2

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GC-rich sequence DNA-binding factor 2

Protein Size: 781

Purification: Affinity Purified

• Artikelnummer: AVIARP58089_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58089_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6936
• Wirt: Rabbit