GEMIN4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GEMIN4

Key Reference: Shpargel,K.B. (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (48), 17372-17377

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gem (Nuclear organelle) associated protein 4 EMBL AAH20062.1

Protein Size: 1058

Purification: Affinity Purified

• Artikelnummer: AVIARP56757_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56757_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 50628
• Wirt: Rabbit