GKN1 Antibody

GKN1 Antibody
Artikelnummer
ASBKC-1018-100
Verpackungseinheit
100 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: Q9NS71

Gene Name: GKN1

Immunogen: Recombinant human GKN1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 72%

Core Sequence: SVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSV

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 28%, Pig - 79%, Cynomolgus monkey - 93%

Alternative gene names: AMP18;CA11

Alternative protein names: Gastrokine-1; 18 kDa antrum mucosa protein; AMP-18; Protein CA11

Protein name: Gastrokine 1

Product panel: Cytokines

Clone No.: K40038_11H2

Antigen Species: Human

Target Name: GKN1

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-403

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-1018-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-1018-100
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Monoclonal
Methode Western Blotting, Immunohistochemistry, Immunocytochemistry
Isotyp IgG1
Human Gene ID 56287
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×