GLS Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS

Key Reference: Sahai (1983) [PubMed 6825316]

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaminase kidney isoform, mitochondrial

Protein Size: 669

Purification: Affinity Purified

• Artikelnummer: AVIARP55098_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55098_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2744
• Wirt: Rabbit