GNAI3 Antibody - N-terminal region : FITC

GNAI3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58905_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(k) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP58905_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58905_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2773
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×