GPD1L Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L

Key Reference: London,B., (2007) Circulation 116 (20), 2260-2268

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein

Protein Size: 351

Purification: Affinity Purified

• Artikelnummer: AVIARP55177_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55177_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23171
• Wirt: Rabbit