GPS1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: VQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: COP9 signalosome complex subunit 1

Protein Size: 491

Purification: Affinity Purified

Subunit: 1

• Artikelnummer: AVIARP57999_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57999_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2873
• Wirt: Rabbit