English
GRK5 Antibody - C-terminal region : Biotin
GRK5 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54751_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GRK5
Molecular Weight: 53kDa
Peptide Sequence: Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: G protein-coupled receptor kinase 5
Protein Size: 485
Purification: Affinity Purified
Description of Target: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GRK5
Molecular Weight: 53kDa
Peptide Sequence: Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: G protein-coupled receptor kinase 5
Protein Size: 485
Purification: Affinity Purified
| Artikelnummer | AVIARP54751_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54751_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 2869 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
