GSTP1 Antibody

GSTP1 Antibody
Artikelnummer
ASBKC-1007-50
Verpackungseinheit
50 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: P09211

Gene Name: GSTP1

Immunogen: Recombinant human GSTP1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 85%

Core Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: FAEES3;GST3

Alternative protein names: Glutathione S-transferase P; GST class-pi; GSTP1-1

Protein name: Glutathione S-transferase pi 1

Clone No.: K52024_1H2

Antigen Species: Human

Target Name: GSTP1

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-592

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-1007-50
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-1007-50
Verpackungseinheit 50 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Western Blotting
Isotyp IgG1
Human Gene ID 2950
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×