HDDC3 Antibody - middle region : HRP

HDDC3 Antibody - middle region : HRP
Artikelnummer
AVIARP55898_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDDC3

Key Reference: Zody,M.C., (2006) Nature 440 (7084), 671-675

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

Protein Size: 140

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55898_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55898_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374659
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×