HEMGN Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEMGN

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hemogen

Protein Size: 484

Purification: Affinity Purified

• Artikelnummer: AVIARP57794_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57794_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55363
• Wirt: Rabbit