Uniprot: O94992
Gene Name: HEXIM1
Immunogen: Recombinant human HEXIM1
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 96%
Core Sequence: WGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLL
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%
Alternative gene names: CLP1；EDG1；HIS1；MAQ1
Alternative protein names: Protein HEXIM1; Cardiac lineage protein 1; Estrogen down-regulated gene 1 protein; Hexamethylene bis-acetamide-inducible protein 1; Menage a quatre protein 1
Protein name: HEXIM P-TEFb complex subunit 1
Clone No.: K40046_17C2
Antigen Species: Human
Target Name: HEXIM1
IHC Verification: succeed
IHC Dilution: 1:100~1:200
WB Verification: -
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-712
Cross reactivity: Not tested
Deutsch
English
