HIKESHI Antibody - N-terminal region : HRP

HIKESHI Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56902_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat l7Rn6

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein Hikeshi

Protein Size: 158

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56902_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56902_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 293103
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×