HIRIP3 Antibody - middle region : HRP

HIRIP3 Antibody - middle region : HRP
Artikelnummer
AVIARP58286_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIRIP3

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HIRA-interacting protein 3

Protein Size: 556

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58286_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58286_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8479
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×