HMGB2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HMGB2 is a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HMGB2

Key Reference: 0

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: High mobility group protein B2

Protein Size: 209

Purification: Affinity Purified

• Artikelnummer: AVIARP58158_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58158_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3148
• Wirt: Rabbit