HMGCLL1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCLL1

Key Reference: Mitchell,G.A., (1993) J. Biol. Chem. 268 (6), 4376-4381

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic

Protein Size: 340

Purification: Affinity Purified

• Artikelnummer: AVIARP56277_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56277_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54511
• Wirt: Rabbit