HNRNPK Antibody

Uniprot: P61978

Gene Name: HNRNPK

Immunogen: Recombinant human HNRNPK

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 100%

Core Sequence: PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HNRPK

Alternative protein names: Heterogeneous nuclear ribonucleoprotein K; hnRNP K; Transformation up-regulated nuclear protein; TUNP

Protein name: Heterogeneous nuclear ribonucleoprotein K

Clone No.: K06321_10G7

Antigen Species: Human

Target Name: HNRNPK

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-333

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1020-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1020-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Western Blotting
• Isotyp: IgG1
• Human Gene ID: 3190
• Wirt: Mouse
• Konjugat: Unconjugated