HOM-TES-103 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOM-TES-103

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 200

Purification: Affinity Purified

• Artikelnummer: AVIARP55421_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55421_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25900
• Wirt: Rabbit