HS1BP3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HS1BP3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HCLS1-binding protein 3

Protein Size: 392

Purification: Affinity Purified

• Artikelnummer: AVIARP57633_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57633_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64342
• Wirt: Rabbit