Igf2bp1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Igf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor 2 mRNA-binding protein 1

Protein Size: 577

Purification: Affinity Purified

• Artikelnummer: AVIARP58385_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58385_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 140486
• Wirt: Rabbit