IL8/CXCL8 Antibody

IL8/CXCL8 Antibody
Artikelnummer
ASBKC-060-100
Verpackungseinheit
100 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: P10145

Gene Name: CXCL8

Immunogen: Recombinant human CXCL8

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 53%

Core Sequence: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%

Alternative gene names: IL8

Alternative protein names: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8)77; GCP/IL-8 protein II; IL-8(1-77); IL8/NAP1 form II; MDNCF-b; IL-8(5-77; IL-8(6-77; (Ser-IL-8)72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8(7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8(8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8(9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]

Protein name: C-X-C motif chemokine ligand 8

Product panel: Cytokines

Clone No.: K06289_9F3

Antigen Species: Human

Target Name: CXCL8

IHC Verification: succeed

IHC Dilution: 1:250~1:500

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-530

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-060-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-060-100
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Western Blotting, ELISA, Immunohistochemistry, Immunocytochemistry
Isotyp IgG1
Human Gene ID 3576
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×