ILDR1 Antibody - middle region : FITC

ILDR1 Antibody - middle region : FITC
Artikelnummer
AVIARP55751_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ILDR1 is a putative membrane receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Key Reference: Hauge,H., (2004) Biochem. Biophys. Res. Commun. 323 (3), 970-978

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Immunoglobulin-like domain-containing receptor 1

Protein Size: 502

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55751_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55751_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286676
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×