IMPA1 Antibody - middle region : Biotin

IMPA1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58713_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPA1

Key Reference: Ohnishi,T., (2007) J. Biol. Chem. 282 (1), 637-646

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 1

Protein Size: 277

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58713_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58713_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3612
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×