IPPK Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IPPK

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-pentakisphosphate 2-kinase

Protein Size: 491

Purification: Affinity Purified

• Artikelnummer: AVIARP57655_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57655_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64768
• Wirt: Rabbit