ITGB3BP Antibody - N-terminal region : Biotin

ITGB3BP Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54999_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. It induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP may also act as an inhibitor of cyclin A-associated kinase. ITGB3BP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ITGB3BP

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein R

Protein Size: 177

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54999_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54999_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23421
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×