ITGB3BP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITGB3BP

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein R

Protein Size: 216

Purification: Affinity Purified

• Artikelnummer: AVIARP55000_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55000_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23421
• Wirt: Rabbit