KIAA0692 Antibody - middle region : FITC

KIAA0692 Antibody - middle region : FITC
Artikelnummer
AVIARP55170_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0692

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat and LEM domain-containing protein 2

Protein Size: 938

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55170_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55170_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23141
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×