KIF5C Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C

Key Reference: Cho,K.I., (2007) Traffic 8 (12), 1722-1735

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kinesin heavy chain isoform 5C

Protein Size: 957

Purification: Affinity Purified

• Artikelnummer: AVIARP54737_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54737_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3800
• Wirt: Rabbit