KRAS Antibody - N-terminal region : HRP

KRAS Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55408_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTPase NRas

Protein Size: 189

Purification: Affinity Purified

Specificity#: 100% homologous to human KRAS, NRAS and HRAS.
Mehr Informationen
Artikelnummer AVIARP55408_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55408_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3845
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×