LAMP1 Antibody - N-terminal region : Biotin

LAMP1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58911_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58911_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58911_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 3916
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×