LSM14A Antibody - C-terminal region : Biotin

LSM14A Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55289_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein LSM14 homolog A

Protein Size: 463

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55289_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55289_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 26065
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×