MAPK4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK4

Key Reference: Murtagh,J.J. (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6870-6875

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 4

Protein Size: 587

Purification: Affinity Purified

• Artikelnummer: AVIARP56433_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56433_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5596
• Wirt: Rabbit